PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0011s0260.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 343aa    MW: 38237.7 Da    PI: 4.5249
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0011s0260.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.8e-092863192255
                             SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                              +yp+++++  LA+++gL+ +q+ +WF N+R ++
  SapurV1A.0011s0260.1.p 286 WPYPTEADKVALAESTGLEPKQINNWFINQRKRH 319
                             69*****************************885 PP

2ELK284.9e-10239260122
                     ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                             ELK++Ll KYsgy+++Lk+E+s
  SapurV1A.0011s0260.1.p 239 ELKDRLLCKYSGYISTLKHELS 260
                             9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.2E-2398142IPR005540KNOX1
PfamPF037902.2E-2199141IPR005540KNOX1
SMARTSM012561.2E-26150201IPR005541KNOX2
PfamPF037913.2E-23154200IPR005541KNOX2
PfamPF037899.1E-8239260IPR005539ELK domain
PROSITE profilePS512139.62239259IPR005539ELK domain
SMARTSM011887.8E-6239260IPR005539ELK domain
PROSITE profilePS5007112.374259322IPR001356Homeobox domain
SuperFamilySSF466891.28E-18260334IPR009057Homeodomain-like
SMARTSM003899.7E-13261326IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.5E-27264324IPR009057Homeodomain-like
CDDcd000866.01E-13271323No hitNo description
PfamPF059201.2E-15279318IPR008422Homeobox KN domain
PROSITE patternPS000270297320IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MMEQLYGIQS TGTDYSLPVS SENEVAPVVA NYYQHMGFPS EAGGASFPFS GSEQLFCGST  60
VSDAASMVVE LHQQLQLQQR GGGCIGDNSN ISQEEASCAI RDKIASHPLY PRLLEAYIDC  120
QKVGAPPEMA YLLDEIREEN DVSKRSNNIV ASCLGADPEL DEFMETYCDV LMKYKADLSR  180
PFDEATAFLN EIEAQFKTLC NGASRSQAYD EAVGSSDEEA SGGEADVQDC TRANEEDREL  240
KDRLLCKYSG YISTLKHELS KKKKKGKLPK EAKKILLDWW TIHNKWPYPT EADKVALAES  300
TGLEPKQINN WFINQRKRHW KPSENTQVAF VDSLYGPFFT ND*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028533.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-108KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLB9RAZ81e-143B9RAZ8_RICCO; Homeobox protein knotted-1, putative
STRINGVIT_17s0000g08710.t011e-139(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-99KNOTTED1-like homeobox gene 6